Structure of PDB 5nd9 Chain P

Receptor sequence
>5nd9P (length=133) Species: 93061 (Staphylococcus aureus subsp. aureus NCTC 8325) [Search protein sequence]
PKRVKYRRQHRPKTTGRSKGGNYVTFGEFGLQATTTSWITSRQIESARIA
MTRYMKRGGKVWIKIFPHTPYTKKPLEVRMGAGKGAVEGWIAVVKPGRIL
FEVAGVSEEVAREALRLASHKLPVKTKFVKREE
3D structure
PDB5nd9 Structures and dynamics of hibernating ribosomes from Staphylococcus aureus mediated by intermolecular interactions of HPF.
ChainP
Resolution3.7 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna P K8 R10 R11 H13 P15 K16 T17 N25 W41 R45 Q46 S49 R56 W65 F69 H71 K76 L79 V81 R82 M83 G84 A85 G86 K87 H123 K124 K128 K5 R7 R8 H10 P12 K13 T14 N22 W38 R42 Q43 S46 R53 W62 F66 H68 K73 L76 V78 R79 M80 G81 A82 G83 K84 H120 K121 K125
Gene Ontology
Molecular Function
GO:0000049 tRNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5nd9, PDBe:5nd9, PDBj:5nd9
PDBsum5nd9
PubMed28645916
UniProtQ2FW13|RL16_STAA8 Large ribosomal subunit protein uL16 (Gene Name=rplP)

[Back to BioLiP]