Structure of PDB 5mam Chain P

Receptor sequence
>5mamP (length=30) Species: 9606 (Homo sapiens) [Search protein sequence]
FVNQHLCGSHLVEALYLVCGERGFFYTPKT
3D structure
PDB5mam Computational and structural evidence for neurotransmitter-mediated modulation of the oligomeric states of human insulin in storage granules.
ChainP
Resolution2.2 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide P F1 V2 H5 F1 V2 H5
BS02 peptide P H5 G8 S9 V12 Y16 G23 F24 F25 Y26 P28 H5 G8 S9 V12 Y16 G23 F24 F25 Y26 P28
BS03 peptide P C7 L11 L15 C19 R22 G23 F24 F25 Y26 T30 C7 L11 L15 C19 R22 G23 F24 F25 Y26 T30
Gene Ontology
Molecular Function
GO:0005179 hormone activity
Cellular Component
GO:0005576 extracellular region

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:5mam, PDBe:5mam, PDBj:5mam
PDBsum5mam
PubMed28348075
UniProtP01308|INS_HUMAN Insulin (Gene Name=INS)

[Back to BioLiP]