Structure of PDB 5lj3 Chain P

Receptor sequence

>5lj3P (length=36) Species: 4932 (Saccharomyces cerevisiae)

PQLEARSGAKAAAYTPTGIEHARLLPGHTTLKYRKF

3D structure

• PDB: 5lj3 Cryo-EM structure of the spliceosome immediately after branching.
• Chain: P
• Resolution: 3.8 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	P	R29 P32 G33 H34 T35	R23 P26 G27 H28 T29
BS02	rna	P	L9 E10 A11	L3 E4 A5
BS03	rna	P	Q8 L9 E10 R12 A15 K16 R29	Q2 L3 E4 R6 A9 K10 R23

Gene Ontology

Molecular Function

• GO:0003674 molecular_function
• GO:0003723 RNA binding
• GO:0005515 protein binding

Biological Process

• GO:0000398 mRNA splicing, via spliceosome
• GO:0006397 mRNA processing
• GO:0008380 RNA splicing
• GO:0045292 mRNA cis splicing, via spliceosome

Cellular Component

• GO:0005634 nucleus
• GO:0005681 spliceosomal complex
• GO:0005684 U2-type spliceosomal complex
• GO:0071013 catalytic step 2 spliceosome

External links

• PDB: RCSB:5lj3, PDBe:5lj3, PDBj:5lj3
• PDBsum: 5lj3
• PubMed: 27459055
• UniProt: Q03772|CWC15_YEAST Pre-mRNA-splicing factor CWC15 (Gene Name=CWC15)