Structure of PDB 5li0 Chain P

Receptor sequence

>5li0P (length=141) Species: 93061 (Staphylococcus aureus subsp. aureus NCTC 8325)

MLLPKRVKYRRQHRPKTTGRSKGGNYVTFGEFGLQATTTSWITSRQIESA
RIAMTRYMKRGGKVWIKIFPHTPYTKKPLEVRMGAGKGAVEGWIAVVKPG
RILFEVAGVSEEVAREALRLASHKLPVKTKFVKREELGGET

3D structure

• PDB: 5li0 Structure of the 70S ribosome from human pathogen Staphylococcus aureus.
• Chain: P
• Resolution: 3.8 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	P	M1 L2 V7 K8 R10 R11 H13 P15 T18 N25 T28 W41 R45 Q46 S49 R56 W65 H71 E80 V81 R82 M83 G84 A85 G86 K87 R101 H123 K124	M1 L2 V7 K8 R10 R11 H13 P15 T18 N25 T28 W41 R45 Q46 S49 R56 W65 H71 E80 V81 R82 M83 G84 A85 G86 K87 R101 H123 K124
BS02	rna	P	R20 T38 T39 S40 W41 T141	R20 T38 T39 S40 W41 T141

Gene Ontology

Molecular Function

• GO:0000049 tRNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:5li0, PDBe:5li0, PDBj:5li0
• PDBsum: 5li0
• PubMed: 27906650
• UniProt: Q2FW13|RL16_STAA8 Large ribosomal subunit protein uL16 (Gene Name=rplP)