Structure of PDB 5hkv Chain P

Receptor sequence

>5hkvP (length=112) Species: 93061 (Staphylococcus aureus subsp. aureus NCTC 8325)

MEAKAVARTIRIAPRKVRLVLDLIRGKNAAEAIAILKLTNKASSPVIEKV
LMSALANAEHNYDMNTDELVVKEAYANEGPTLKRFRPRAQGRASAINKRT
SHITIVVSDGKE

3D structure

• PDB: 5hkv Structural insights of lincosamides targeting the ribosome of Staphylococcus aureus.
• Chain: P
• Resolution: 3.66 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	P	V6 R8 R11 R15 K16 R18 R25 N40 K41 S53 A56 N57 H60 N61 Y62 N77 E78 P80 K83 R84 R86 P87 R88 A89 Q90 G91 R92 A93 S94 A95 N97 R99 H102	V6 R8 R11 R15 K16 R18 R25 N40 K41 S53 A56 N57 H60 N61 Y62 N77 E78 P80 K83 R84 R86 P87 R88 A89 Q90 G91 R92 A93 S94 A95 N97 R99 H102

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0015934 large ribosomal subunit
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:5hkv, PDBe:5hkv, PDBj:5hkv
• PDBsum: 5hkv
• PubMed: 28973455
• UniProt: Q2FW11|RL22_STAA8 Large ribosomal subunit protein uL22 (Gene Name=rplV)