Structure of PDB 4u3f Chain P

Receptor sequence

>4u3fP (length=379) Species: 9031 (Gallus gallus) [Search protein sequence]

APNIRKSHPLLKMINNSLIDLPAPSNISAWWNFGSLLAVCLMTQILTGLL
LAMHYTADTSLAFSSVAHTCRNVQYGWLIRNLHANGASFFFICIFLHIGR
GLYYGSYLYKETWNTGVILLLTLMATAFVGYVLPWGQMSFWGATVITNLF
SAIPYIGHTLVEWAWGGFSVDNPTLTRFFALHFLLPFAIAGITIIHLTFL
HESGSNNPLGISSDSDKIPFHPYYSFKDILGLTLMLTPFLTLALFSPNLL
GDPENFTPANPLVTPPHIKPEWYFLFAYAILRSIPNKLGGVLALAASVLI
LFLIPFLHKSKQRTMTFRPLSQTLFWLLVANLLILTWIGSQPVEHPFIII
GQMASLSYFTILLILFPTIGTLENKMLNY

3D structure

PDB

4u3f Rational Design of Highly Potent and Slow-Binding Cytochrome bc1 Inhibitor as Fungicide by Computational Substitution Optimization

Chain

Resolution

3.2312 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	HEM	P	Q45 G49 L50 L52 A53 R81 H84 A88 F91 T127 G131 L134 P135 H183 F184 P187	Q44 G48 L49 L51 A52 R80 H83 A87 F90 T126 G130 L133 P134 H182 F183 P186
BS02	HEM	P	W32 G35 L38 F91 H98 I99 R101 S107 T113 W114 G117 L120 H197 L198 L201 S206 N207	W31 G34 L37 F90 H97 I98 R100 S106 T112 W113 G116 L119 H196 L197 L200 S205 N206
BS03	Y52	P	M125 A126 F129 Y132 G143 A144 I147 K270 P271 E272 Y274 F275	M124 A125 F128 Y131 G142 A143 I146 K269 P270 E271 Y273 F274
BS04	U10	P	S18 L19 L22 H202 S206 F221	S17 L18 L21 H201 S205 F220

Gene Ontology

	Molecular Function
GO:0008121	ubiquinol-cytochrome-c reductase activity
GO:0009055	electron transfer activity
GO:0016491	oxidoreductase activity
GO:0020037	heme binding
GO:0046872	metal ion binding

	Biological Process
GO:0006122	mitochondrial electron transport, ubiquinol to cytochrome c
GO:0006979	response to oxidative stress
GO:0022904	respiratory electron transport chain
GO:1902600	proton transmembrane transport

	Cellular Component
GO:0005737	cytoplasm
GO:0005739	mitochondrion
GO:0005743	mitochondrial inner membrane
GO:0016020	membrane
GO:0045275	respiratory chain complex III

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:4u3f, PDBe:4u3f, PDBj:4u3f
PDBsum	4u3f
PubMed
UniProt	P18946\|CYB_CHICK Cytochrome b (Gene Name=MT-CYB)

[Back to BioLiP]