Structure of PDB 4kx6 Chain P |
>4kx6P (length=119) Species: 83333 (Escherichia coli K-12) [Search protein sequence] |
MINPNPKRSDEPVFWGLFGAGGMWSAIIAPVMILLVGILLPLGLFPGDAL SYERVLAFAQSFIGRVFLFLMIVLPLWCGLHRMHHAMHDLKIHVPAGKWV FYGLAAILTVVTLIGVVTI |
|
PDB | 4kx6 Plasticity of the Quinone-binding Site of the Complex II Homolog Quinol:Fumarate Reductase. |
Chain | P |
Resolution | 2.95 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
MQ7 |
P |
W14 F17 G18 H84 |
W15 F18 G19 H85 |
|
|
|
|