Structure of PDB 4ji4 Chain P

Receptor sequence
>4ji4P (length=83) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]
MVKIRLARFGSKHNPHYRIVVTDARRKRDGKYIEKIGYYDPRKTTPDWLK
VDVERARYWLSVGAQPTDTARRLLRQAGVFRQE
3D structure
PDB4ji4 The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
ChainP
Resolution3.692 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna P M1 K3 R5 L6 R8 F9 S11 K12 H13 H16 Y17 R18 D23 R25 R26 K27 R28 K35 Y38 P41 K43 T44 V62 G63 T67 D68 T69 R72 R75 R81 Q82 M1 K3 R5 L6 R8 F9 S11 K12 H13 H16 Y17 R18 D23 R25 R26 K27 R28 K35 Y38 P41 K43 T44 V62 G63 T67 D68 T69 R72 R75 R81 Q82
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4ji4, PDBe:4ji4, PDBj:4ji4
PDBsum4ji4
PubMed24152548
UniProtQ5SJH3|RS16_THET8 Small ribosomal subunit protein bS16 (Gene Name=rpsP)

[Back to BioLiP]