Structure of PDB 4io9 Chain P

Receptor sequence

>4io9P (length=127) Species: 1299 (Deinococcus radiodurans) [Search protein sequence]

FRNKKQRKQQVKLRKPGFAVAKYVRMSPRKVRLVVDVIRGKSVQDAEDLL
RFIPRSASEPVAKVLNSAKANALHNDEMLEDRLFVKEAYVDAGPTLKRLI
PRARGSANIIKKRTSHITIIVAEKGNK

3D structure

PDB

4io9 Novel 3-O-carbamoyl erythromycin A derivatives (carbamolides) with activity against resistant staphylococcal and streptococcal isolates.

Chain

Resolution

3.2 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	P	R9 K11 K12 R14 K15 Q16 K19 L20 R21 K22 V27 K29 Y30 R32 S34 R36 K37 R39 R46 R62 S63 K70 N73 S74 A77 N78 H81 N82 D98 A99 P101 K104 R105 P108 R109 A110 R111 G112 S113 A114 N115 I117 K118 K119 R120 H123 N133 K134	R2 K4 K5 R7 K8 Q9 K12 L13 R14 K15 V20 K22 Y23 R25 S27 R29 K30 R32 R39 R55 S56 K63 N66 S67 A70 N71 H74 N75 D91 A92 P94 K97 R98 P101 R102 A103 R104 G105 S106 A107 N108 I110 K111 K112 R113 H116 N126 K127

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0015934	large ribosomal subunit
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:4io9, PDBe:4io9, PDBj:4io9
PDBsum	4io9
PubMed	23414806
UniProt	Q9RXJ7\|RL22_DEIRA Large ribosomal subunit protein uL22 (Gene Name=rplV)