Structure of PDB 4dv5 Chain P

Receptor sequence
>4dv5P (length=83) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]
MVKIRLARFGSKHNPHYRIVVTDARRKRDGKYIEKIGYYDPRKTTPDWLK
VDVERARYWLSVGAQPTDTARRLLRQAGVFRQE
3D structure
PDB4dv5 A structural basis for streptomycin resistance
ChainP
Resolution3.683 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna P M1 V2 K3 R5 L6 R8 F9 K12 H13 H16 Y17 R18 D23 R25 R26 K27 R28 G30 K35 Y38 K43 T44 W59 V62 G63 Q65 T67 D68 T69 R72 R75 R81 Q82 M1 V2 K3 R5 L6 R8 F9 K12 H13 H16 Y17 R18 D23 R25 R26 K27 R28 G30 K35 Y38 K43 T44 W59 V62 G63 Q65 T67 D68 T69 R72 R75 R81 Q82
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4dv5, PDBe:4dv5, PDBj:4dv5
PDBsum4dv5
PubMed
UniProtQ5SJH3|RS16_THET8 Small ribosomal subunit protein bS16 (Gene Name=rpsP)

[Back to BioLiP]