Structure of PDB 4dr3 Chain P

Receptor sequence

>4dr3P (length=83) Species: 300852 (Thermus thermophilus HB8)

MVKIRLARFGSKHNPHYRIVVTDARRKRDGKYIEKIGYYDPRKTTPDWLK
VDVERARYWLSVGAQPTDTARRLLRQAGVFRQE

3D structure

• PDB: 4dr3 A structural basis for streptomycin-induced misreading of the genetic code.
• Chain: P
• Resolution: 3.348 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	P	M1 K3 R5 L6 R8 F9 K12 H13 H16 Y17 R18 D23 R25 K27 R28 G30 K31 P41 K43 T44 G63 Q65 T67 D68 T69 R72 R75 R81 Q82	M1 K3 R5 L6 R8 F9 K12 H13 H16 Y17 R18 D23 R25 K27 R28 G30 K31 P41 K43 T44 G63 Q65 T67 D68 T69 R72 R75 R81 Q82

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005840 ribosome
• GO:0015935 small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:4dr3, PDBe:4dr3, PDBj:4dr3
• PDBsum: 4dr3
• PubMed: 23322043
• UniProt: Q5SJH3|RS16_THET8 Small ribosomal subunit protein bS16 (Gene Name=rpsP)