Structure of PDB 4dr2 Chain P

Receptor sequence

>4dr2P (length=83) Species: 300852 (Thermus thermophilus HB8)

MVKIRLARFGSKHNPHYRIVVTDARRKRDGKYIEKIGYYDPRKTTPDWLK
VDVERARYWLSVGAQPTDTARRLLRQAGVFRQE

3D structure

• PDB: 4dr2 A structural basis for streptomycin-induced misreading of the genetic code.
• Chain: P
• Resolution: 3.249 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	P	M1 K3 R5 L6 R8 F9 G10 S11 K12 H13 H16 R18 D23 R25 R26 K27 R28 G30 K31 I33 P41 K43 T44 T45 V62 G63 Q65 T67 T69 R72 F80 R81 Q82 E83	M1 K3 R5 L6 R8 F9 G10 S11 K12 H13 H16 R18 D23 R25 R26 K27 R28 G30 K31 I33 P41 K43 T44 T45 V62 G63 Q65 T67 T69 R72 F80 R81 Q82 E83

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005840 ribosome
• GO:0015935 small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:4dr2, PDBe:4dr2, PDBj:4dr2
• PDBsum: 4dr2
• PubMed: 23322043
• UniProt: Q5SJH3|RS16_THET8 Small ribosomal subunit protein bS16 (Gene Name=rpsP)