Structure of PDB 4d6u Chain P

Receptor sequence

>4d6uP (length=370) Species: 9913 (Bos taurus)

LMKIVNNAFIDLPAPSNISSWWNFGSLLGICLILQILTGLFLAMHYTSDT
TTAFSSVTHICRDVNYGWIIRYMHANGASMFFICLYMHVGRGLYYGSYTF
LETWNIGVILLLTVMATAFMGYVLPWGQMSFWGATVITNLLSAIPYIGTN
LVEWIWGGFSVDKATLTRFFAFHFILPFIIMAIAMVHLLFLHETGSNNPT
GISSDVDKIPFHPYYTIKDILGALLLILALMLLVLFAPDLLGDPDNYTPA
NPLNTPPHIKPEWYFLFAYAILRSIPNKLGGVLALAFSILILALIPLLHT
SKQRSMMFRPLSQCLFWALVADLLTLTWIGGQPVEHPYITIGQLASVLYF
LLILVLMPTAGTIENKLLKW

3D structure

• PDB: 4d6u Antimalarial 4(1H)-Pyridones Bind to the Qi Site of Cytochrome Bc1.
• Chain: P
• Resolution: 4.09 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	HEM	P	Q44 I45 G48 L49 L51 A52 R80 H83 T126 A127 G130 L133 P134 H182 F183 P186	Q35 I36 G39 L40 L42 A43 R71 H74 T117 A118 G121 L124 P125 H173 F174 P177
BS02	HEM	P	W31 G34 L37 F90 H97 R100 S106 W113 G116 V117 L119 H196 L200 S205 N206	W22 G25 L28 F81 H88 R91 S97 W104 G107 V108 L110 H187 L191 S196 N197
BS03	G8U	P	F18 L21 G38 A193 L197 H201 S205 F220	F9 L12 G29 A184 L188 H192 S196 F211

Gene Ontology

Molecular Function

• GO:0008121 ubiquinol-cytochrome-c reductase activity
• GO:0009055 electron transfer activity
• GO:0016491 oxidoreductase activity
• GO:0020037 heme binding
• GO:0046872 metal ion binding
• GO:0048039 ubiquinone binding

Biological Process

• GO:0006122 mitochondrial electron transport, ubiquinol to cytochrome c
• GO:0022904 respiratory electron transport chain
• GO:1902600 proton transmembrane transport

Cellular Component

• GO:0005739 mitochondrion
• GO:0005743 mitochondrial inner membrane
• GO:0016020 membrane
• GO:0031966 mitochondrial membrane
• GO:0045275 respiratory chain complex III

External links

• PDB: RCSB:4d6u, PDBe:4d6u, PDBj:4d6u
• PDBsum: 4d6u
• PubMed: 25564664
• UniProt: P00157|CYB_BOVIN Cytochrome b (Gene Name=MT-CYB)