Structure of PDB 4d61 Chain P

Receptor sequence

>4d61P (length=118) Species: 9986 (Oryctolagus cuniculus) [Search protein sequence]

FRKFTYRGVDLDQLLDMSYEQLMQLYSARQRRRLNRGLRRKQHSLLKRLR
KAKKEAPPMEKPEVVKTHLRDMIILPEMVGSMVGVYNGKTFNQVEIKPEM
IGHYLGEFSITYKPVKHG

3D structure

PDB

4d61 Cryo-Em of Ribosomal 80S Complexes with Termination Factors Reveals the Translocated Cricket Paralysis Virus Ires.

Chain

Resolution

9.0 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	P	S38 A39 R40 R42 R43 R44 R47 K52 K77 T78 H79 R81 D82 Y97 N98 G99 K100 F102 Y115 E118 Y123 K124 V126 K127 H128 G129	S27 A28 R29 R31 R32 R33 R36 K41 K66 T67 H68 R70 D71 Y86 N87 G88 K89 F91 Y104 E107 Y112 K113 V115 K116 H117 G118

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0097371	MDM2/MDM4 family protein binding
GO:1990948	ubiquitin ligase inhibitor activity

	Biological Process
GO:0000028	ribosomal small subunit assembly
GO:0000056	ribosomal small subunit export from nucleus
GO:0006364	rRNA processing
GO:0006412	translation
GO:0042274	ribosomal small subunit biogenesis
GO:1901798	positive regulation of signal transduction by p53 class mediator

	Cellular Component
GO:0005737	cytoplasm
GO:0005840	ribosome
GO:0015935	small ribosomal subunit
GO:0022626	cytosolic ribosome
GO:0022627	cytosolic small ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:4d61, PDBe:4d61, PDBj:4d61
PDBsum	4d61
PubMed	25601755
UniProt	G1U0Q2\|RS15_RABIT Small ribosomal subunit protein uS19 (Gene Name=RPS15)