Structure of PDB 4cqm Chain P

Receptor sequence
>4cqmP (length=248) Species: 9606 (Homo sapiens) [Search protein sequence]
SQLQNRLRSALALVTGAGSGIGRAVSVRLAGEGATVAACDLDRAAAQETV
RLLGNHAAFQADVSEARAARCLLEQVQACFSRPPSVVVSCAGITQDEFLL
HMSEDDWDKVIAVNLKGTFLVTQAAAQALVSNGCRGSIINISSIVGKVGN
VGQTNYAASKAGVIGLTQTAARELGRHGIRCNSVLPGFIATPMTQKVPQK
VVDKITEMIPMGHLGDPEDVADVVAFLASEDSGYITGTSVEVTGGLFM
3D structure
PDB4cqm Insights Into Mitochondrial Fatty Acid Synthesis from the Structure of Heterotetrameric 3-Ketoacyl-Acp Reductase/3R-Hydroxyacyl-Coa Dehydrogenase.
ChainP
Resolution2.339 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) G22 S156 Y169 K173
Catalytic site (residue number reindexed from 1) G20 S143 Y156 K160
Enzyme Commision number 1.1.1.239: 3alpha-(17beta)-hydroxysteroid dehydrogenase (NAD(+)).
1.1.1.62: 17beta-estradiol 17-dehydrogenase.
1.1.1.n12: (3R)-hydroxyacyl-CoA dehydrogenase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 NAP P G18 S21 I23 D42 L43 A74 D75 V76 C103 G105 I106 V126 S155 S156 Y169 K173 P199 G200 T204 P205 M206 G16 S19 I21 D40 L41 A61 D62 V63 C90 G92 I93 V113 S142 S143 Y156 K160 P186 G187 T191 P192 M193 MOAD: Kd=26.8uM
Gene Ontology
Molecular Function
GO:0004303 estradiol 17-beta-dehydrogenase [NAD(P)+] activity
GO:0005515 protein binding
GO:0016491 oxidoreductase activity
GO:0047035 testosterone dehydrogenase (NAD+) activity
GO:0070404 NADH binding
GO:0106386 (3R)-hydroxyacyl-CoA dehydrogenase (NAD+) activity
Biological Process
GO:0006633 fatty acid biosynthetic process
GO:0006694 steroid biosynthetic process
GO:0006703 estrogen biosynthetic process
GO:0008209 androgen metabolic process
GO:0008210 estrogen metabolic process
GO:0051290 protein heterotetramerization
Cellular Component
GO:0005739 mitochondrion
GO:0005740 mitochondrial envelope
GO:0005759 mitochondrial matrix
GO:0005886 plasma membrane
GO:0016020 membrane
GO:1990204 oxidoreductase complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4cqm, PDBe:4cqm, PDBj:4cqm
PDBsum4cqm
PubMed25203508
UniProtQ92506|DHB8_HUMAN (3R)-3-hydroxyacyl-CoA dehydrogenase (Gene Name=HSD17B8)

[Back to BioLiP]