Structure of PDB 3r8b Chain P |
>3r8bP (length=111) Species: 10116 (Rattus norvegicus) [Search protein sequence] |
EAAVTQSPRNKVAVTGEKVTLSCKQTNSYFNNMYWYRQDTGHELRLIFMS HGIRNVEKGDIPDGYKASRPSQENFSLILELATPSQTSVYFCASGGGTLY FGAGTRLSVLY |
|
PDB | 3r8b Molecular basis of a million-fold affinity maturation process in a protein-protein interaction. |
Chain | P |
Resolution | 2.95 Å |
3D structure |
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
P |
E42 R44 |
E43 R45 |
|
BS02 |
ZN |
P |
H50 E56 |
H51 E57 |
|
|
|