Structure of PDB 3pip Chain P

Receptor sequence

>3pipP (length=126) Species: 1299 (Deinococcus radiodurans)

FRNKKQRKQQVKLRKPGFAVAKYVRMSPRKVRLVVDVIRGKSVQDAEDLL
RFIPRSASEPVAKVLNSAKANALHNDEMLEDRLFVKEAYVDAGPTLKRLI
PRARGSANIIKKRTSHITIIVAEKGN

3D structure

• PDB: 3pip Crystal structure of the synergistic antibiotic pair, lankamycin and lankacidin, in complex with the large ribosomal subunit.
• Chain: P
• Resolution: 3.45 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	P	K11 K12 Q13 K15 Q16 K19 L20 R21 K22 F25 A26 V27 A28 Y30 R32 S34 R36 K37 R39 R46 R62 S63 K70 N73 S74 A77 N78 H81 N82 D98 A99 K104 R105 P108 R109 A110 R111 G112 S113 A114 N115 I117 K118 K119 R120	K4 K5 Q6 K8 Q9 K12 L13 R14 K15 F18 A19 V20 A21 Y23 R25 S27 R29 K30 R32 R39 R55 S56 K63 N66 S67 A70 N71 H74 N75 D91 A92 K97 R98 P101 R102 A103 R104 G105 S106 A107 N108 I110 K111 K112 R113

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0015934 large ribosomal subunit
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:3pip, PDBe:3pip, PDBj:3pip
• PDBsum: 3pip
• PubMed: 21282615
• UniProt: Q9RXJ7|RL22_DEIRA Large ribosomal subunit protein uL22 (Gene Name=rplV)