Structure of PDB 3jag Chain P

Receptor sequence

>3jagP (length=153) Species: 9986 (Oryctolagus cuniculus)

VRYSLDPENPTKSCKSRGSNLRVHFKNTRETAQAIKGMHIRKATKYLKDV
TLKKQCVPFRRYNGGVGRCAQAKQWGWTQGRWPKKSAEFLLHMLKNAESN
AELKGLDVDSLVIEHIQVNKAPKMRRRTYRAHGRINPYMSSPCHIEMILT
EKE

3D structure

• PDB: 3jag Structural basis for stop codon recognition in eukaryotes.
• Chain: P
• Resolution: 3.65 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	P	H133 R135	H132 R134
BS02	rna	P	R3 Y4 R18 S20 R23 H25 K27 R30 Q34 K37 K54 K55 R62 Y63 N64 G65 G66 G68 R69 A71 Q72 K74 W78 Q80 R82 W83 P84 K85 K86 N97 S100 N101 L104 Q118 V119 K121 R127 T129 Y130 R131 A132 H133 G134 R135 I136 N137 P138 Y139 M140 S141	R2 Y3 R17 S19 R22 H24 K26 R29 Q33 K36 K53 K54 R61 Y62 N63 G64 G65 G67 R68 A70 Q71 K73 W77 Q79 R81 W82 P83 K84 K85 N96 S99 N100 L103 Q117 V118 K120 R126 T128 Y129 R130 A131 H132 G133 R134 I135 N136 P137 Y138 M139 S140
BS03	rna	P	R3 S5 R61 R62 W78 N120 P123 H145	R2 S4 R60 R61 W77 N119 P122 H144

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Mon Nov 25 12:42:46 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '3jag', asym_id = 'P', title = 'Structural basis for stop codon recognition in eukaryotes.'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='3jag', asym_id='P', title='Structural basis for stop codon recognition in eukaryotes.')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0003735,0005840,0006412,0015934', uniprot = '', pdbid = '3jag', asym_id = 'P'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003735,0005840,0006412,0015934', uniprot='', pdbid='3jag', asym_id='P')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>