Structure of PDB 3j6b Chain P

Receptor sequence

>3j6bP (length=207) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]

DINVSEKIYKWTKAGIEQGKEHFKVGGNKVYFPKARIILLRPNAKHTPYQ
AKFIVPKSFNKLDLRDYLYHIYGLRAMNITTQLLHGKFNRMNLQTTRFRE
PQIKKMTIEMEEPFIWPEEPRPDENSFWDSTTPDNMEKYREERLNCLGSD
ANKPGTAFDGVVGPYERVAQPFIPRFLKREIDNKRERHAAELQRADKLIA
LNRYIED

3D structure

PDB

3j6b Structure of the yeast mitochondrial large ribosomal subunit.

Chain

Resolution

3.2 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	P	N57 V58 I62 W65 F77 K78 N82 K83 K88 A89 L94 R95 N97 K99 K106 P110 K111 S112 N114 K115 R119 T134 T135 Q136 L137 L138 H139 K141 F142 R144 Q148 T150 R151 K158 K159 T161 R229 F230 R233 E234 N237	N3 V4 I8 W11 F23 K24 N28 K29 K34 A35 L40 R41 N43 K45 K52 P56 K57 S58 N60 K61 R65 T80 T81 Q82 L83 L84 H85 K87 F88 R90 Q94 T96 R97 K104 K105 T107 R175 F176 R179 E180 N183

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0005515	protein binding

	Biological Process
GO:0006412	translation
GO:0032543	mitochondrial translation

	Cellular Component
GO:0005739	mitochondrion
GO:0005743	mitochondrial inner membrane
GO:0005762	mitochondrial large ribosomal subunit
GO:0005840	ribosome
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:3j6b, PDBe:3j6b, PDBj:3j6b
PDBsum	3j6b
PubMed	24675956
UniProt	P32387\|RM41_YEAST Large ribosomal subunit protein uL23m (Gene Name=MRP20)

[Back to BioLiP]