Structure of PDB 3j3w Chain P

Receptor sequence
>3j3wP (length=112) Species: 224308 (Bacillus subtilis subsp. subtilis str. 168) [Search protein sequence]
KLIEDITKEQLRTDLPAFRPGDTLRVHVKVVEGNRERIQIFEGVVIKRRG
GGISETFTVRKISYGVGVERTFPVHTPKIAKIEVVRYGKVRRAKLYYLRE
LRGKAARIKEIR
3D structure
PDB3j3w Cryo-EM structures of the late-stage assembly intermediates of the bacterial 50S ribosomal subunit
ChainP
Resolution10.7 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna P K3 R21 I55 S56 E57 T58 H77 R88 K91 R93 R94 A95 K96 L97 Y98 Y99 L100 R101 E102 R109 R114 K1 R19 I53 S54 E55 T56 H75 R86 K89 R91 R92 A93 K94 L95 Y96 Y97 L98 R99 E100 R107 R112
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3j3w, PDBe:3j3w, PDBj:3j3w
PDBsum3j3w
PubMed23700310
UniProtO31742|RL19_BACSU Large ribosomal subunit protein bL19 (Gene Name=rplS)

[Back to BioLiP]