Structure of PDB 3hkz Chain P

Receptor sequence

>3hkzP (length=43) Species: 273057 (Saccharolobus solfataricus P2)

CGKCWKTFTDEQLKVLPGVRCPYCGYKIIFMVRKPTIKIVKAI

3D structure

• PDB: 3hkz The X-ray crystal structure of RNA polymerase from Archaea.
• Chain: P
• Resolution: 3.4 Å

Enzymatic activity

• Enzyme Commision number: 2.7.7.6: DNA-directed RNA polymerase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	ZN	P	C9 C26 C29	C4 C21 C24

Gene Ontology

Molecular Function

• GO:0003677 DNA binding
• GO:0003899 DNA-directed 5'-3' RNA polymerase activity
• GO:0008270 zinc ion binding
• GO:0016779 nucleotidyltransferase activity
• GO:0034062 5'-3' RNA polymerase activity
• GO:0046872 metal ion binding

Biological Process

• GO:0006351 DNA-templated transcription

Cellular Component

• GO:0000428 DNA-directed RNA polymerase complex
• GO:0005737 cytoplasm

External links

• PDB: RCSB:3hkz, PDBe:3hkz, PDBj:3hkz
• PDBsum: 3hkz
• PubMed: 18235446
• UniProt: Q97ZX7|RPO12_SACS2 DNA-directed RNA polymerase subunit Rpo12 (Gene Name=rpo12)