Structure of PDB 3h1h Chain P

Receptor sequence

>3h1hP (length=379) Species: 9031 (Gallus gallus)

APNIRKSHPLLKMINNSLIDLPAPSNISAWWNFGSLLAVCLMTQILTGLL
LAMHYTADTSLAFSSVAHTCRNVQYGWLIRNLHANGASFFFICIFLHIGR
GLYYGSYLYKETWNTGVILLLTLMATAFVGYVLPWGQMSFWGATVITNLF
SAIPYIGHTLVEWAWGGFSVDNPTLTRFFALHFLLPFAIAGITIIHLTFL
HESGSNNPLGISSDSDKIPFHPYYSFKDILGLTLMLTPFLTLALFSPNLL
GDPENFTPANPLVTPPHIKPEWYFLFAYAILRSIPNKLGGVLALAASVLI
LFLIPFLHKSKQRTMTFRPLSQTLFWLLVANLLILTWIGSQPVEHPFIII
GQMASLSYFTILLILFPTIGTLENKMLNY

3D structure

• PDB: 3h1h Electron Transfer by Domain Movement in Cytochrome Bc1
• Chain: P
• Resolution: 3.16 Å

Enzymatic activity

• Enzyme Commision number: 1.10.2.2: Transferred entry: 7.1.1.8.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	HEM	P	Q45 G49 L50 L52 A53 R81 H84 G131 L134 H183 F184 P187	Q44 G48 L49 L51 A52 R80 H83 G130 L133 H182 F183 P186
BS02	HEM	P	W32 G35 L38 H98 R101 S107 T113 W114 G117 V118 L120 H197 L198 L201 S206 N207	W31 G34 L37 H97 R100 S106 T112 W113 G116 V117 L119 H196 L197 L200 S205 N206
BS03	UQ	P	L22 H202 S206 F221	L21 H201 S205 F220

Gene Ontology

Molecular Function

• GO:0008121 ubiquinol-cytochrome-c reductase activity
• GO:0009055 electron transfer activity
• GO:0016491 oxidoreductase activity
• GO:0020037 heme binding
• GO:0046872 metal ion binding

Biological Process

• GO:0006122 mitochondrial electron transport, ubiquinol to cytochrome c
• GO:0006979 response to oxidative stress
• GO:0022904 respiratory electron transport chain
• GO:1902600 proton transmembrane transport

Cellular Component

• GO:0005737 cytoplasm
• GO:0005739 mitochondrion
• GO:0005743 mitochondrial inner membrane
• GO:0016020 membrane
• GO:0045275 respiratory chain complex III

External links

• PDB: RCSB:3h1h, PDBe:3h1h, PDBj:3h1h
• PDBsum: 3h1h
• PubMed: 9565029
• UniProt: P18946|CYB_CHICK Cytochrome b (Gene Name=MT-CYB)