Structure of PDB 3d48 Chain P

Receptor sequence

>3d48P (length=165) Species: 9606 (Homo sapiens)

VTLRDLFDRAVVLSHYIHNLSSEMFSEFDKGFITKAINSCHTSSLATPED
KEQAQQMNQKDFLSLIVSILRSWNEPLYHLVTEVRAILSKAVEIEEQTKR
LLERMELIVSQVIYPVWSGLPSLQMADEESRLSAYYNLLHCLRRDSHKID
NYLKLLKCRIIHNNN

3D structure

• PDB: 3d48 Crystal structure of a prolactin receptor antagonist bound to the extracellular domain of the prolactin receptor
• Chain: P
• Resolution: 2.5 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	CO3	P	S57 H59 L171 C174	S39 H41 L138 C141

Gene Ontology

Molecular Function

• GO:0005148 prolactin receptor binding
• GO:0005179 hormone activity
• GO:0005515 protein binding

Biological Process

• GO:0001937 negative regulation of endothelial cell proliferation
• GO:0007166 cell surface receptor signaling pathway
• GO:0007565 female pregnancy
• GO:0007595 lactation
• GO:0008284 positive regulation of cell population proliferation
• GO:0016525 negative regulation of angiogenesis
• GO:0030879 mammary gland development
• GO:0031667 response to nutrient levels
• GO:0038161 prolactin signaling pathway
• GO:0043123 positive regulation of canonical NF-kappaB signal transduction
• GO:0046427 positive regulation of receptor signaling pathway via JAK-STAT
• GO:1902895 positive regulation of miRNA transcription
• GO:1903489 positive regulation of lactation

Cellular Component

• GO:0005576 extracellular region
• GO:0005615 extracellular space
• GO:0031904 endosome lumen

External links

• PDB: RCSB:3d48, PDBe:3d48, PDBj:3d48
• PDBsum: 3d48
• PubMed: 18467331
• UniProt: P01236|PRL_HUMAN Prolactin (Gene Name=PRL)