Structure of PDB 2zm6 Chain P

Receptor sequence
>2zm6P (length=83) Species: 274 (Thermus thermophilus) [Search protein sequence]
MVKIRLARFGSKHNPHYRIVVTDARRKRDGKYIEKIGYYDPRKTTPDWLK
VDVERARYWLSVGAQPTDTARRLLRQAGVFRQE
3D structure
PDB2zm6 Crystal structure of the Thermus thermophilus 30S ribosomal subunit
ChainP
Resolution3.3 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna P M1 K3 R5 L6 R8 F9 K12 H13 Y17 R18 D23 R25 R26 K27 R28 G30 K31 Y32 Y38 R42 K43 T44 V62 G63 Q65 T67 T69 R72 R75 F80 R81 Q82 M1 K3 R5 L6 R8 F9 K12 H13 Y17 R18 D23 R25 R26 K27 R28 G30 K31 Y32 Y38 R42 K43 T44 V62 G63 Q65 T67 T69 R72 R75 F80 R81 Q82
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2zm6, PDBe:2zm6, PDBj:2zm6
PDBsum2zm6
PubMed
UniProtQ5SJH3|RS16_THET8 Small ribosomal subunit protein bS16 (Gene Name=rpsP)

[Back to BioLiP]