Structure of PDB 2zjq Chain P

Receptor sequence

>2zjqP (length=127) Species: 1299 (Deinococcus radiodurans)

FRNKKQRKQQVKLRKPGFAVAKYVRMSPRKVRLVVDVIRGKSVQDAEDLL
RFIPRSASEPVAKVLNSAKANALHNDEMLEDRLFVKEAYVDAGPTLKRLI
PRARGSANIIKKRTSHITIIVAEKGNK

3D structure

• PDB: 2zjq Translational regulation via L11: molecular switches on the ribosome turned on and off by thiostrepton and micrococcin.
• Chain: P
• Resolution: 3.3 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	P	K11 K12 Q16 K19 R21 K22 V27 K29 Y30 R32 R36 K37 R39 R46 R62 S63 K70 N73 S74 A77 N78 H81 N82 A99 K104 R105 P108 R109 A110 R111 G112 S113 A114 N115 I117 K118 K119 R120 H123 N133 K134	K4 K5 Q9 K12 R14 K15 V20 K22 Y23 R25 R29 K30 R32 R39 R55 S56 K63 N66 S67 A70 N71 H74 N75 A92 K97 R98 P101 R102 A103 R104 G105 S106 A107 N108 I110 K111 K112 R113 H116 N126 K127

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0015934 large ribosomal subunit
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:2zjq, PDBe:2zjq, PDBj:2zjq
• PDBsum: 2zjq
• PubMed: 18406324
• UniProt: Q9RXJ7|RL22_DEIRA Large ribosomal subunit protein uL22 (Gene Name=rplV)