Structure of PDB 2ykr Chain P

Receptor sequence

>2ykrP (length=82) Species: 668369 (Escherichia coli DH5[alpha]) [Search protein sequence]

MVTIRLARHGAKKRPFYQVVVADSRNARNGRFIERVGFFNPIASEKEEGT
RLDLDRIAHWVGQGATISDRVAALIKEVNKAA

3D structure

PDB

2ykr Structural Basis for the Function of a Small Gtpase Rsga on the 30S Ribosomal Subunit Maturation Revealed by Cryoelectron Microscopy.

Chain

Resolution

9.8 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	P	M1 V2 R5 L6 R8 A11 K12 K13 R14 P15 F16 Y17 Q18 S24 R25 N26 A27 R28 G30 R31 F32 R35 F38 F39 P41 I42 A43 S44 E45 K46 E47 E48 R51 W60 G62 Q63 G64 D69 R70 A72 A73 K76 A82	M1 V2 R5 L6 R8 A11 K12 K13 R14 P15 F16 Y17 Q18 S24 R25 N26 A27 R28 G30 R31 F32 R35 F38 F39 P41 I42 A43 S44 E45 K46 E47 E48 R51 W60 G62 Q63 G64 D69 R70 A72 A73 K76 A82

Gene Ontology

	Molecular Function
GO:0000400	four-way junction DNA binding
GO:0003735	structural constituent of ribosome
GO:0004519	endonuclease activity
GO:0004520	DNA endonuclease activity

	Biological Process
GO:0000028	ribosomal small subunit assembly
GO:0002181	cytoplasmic translation
GO:0006259	DNA metabolic process
GO:0006412	translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005840	ribosome
GO:0015935	small ribosomal subunit
GO:0022627	cytosolic small ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:2ykr, PDBe:2ykr, PDBj:2ykr
PDBsum	2ykr
PubMed	21788480
UniProt	P0A7T3\|RS16_ECOLI Small ribosomal subunit protein bS16 (Gene Name=rpsP)