Structure of PDB 2waq Chain P

Receptor sequence

>2waqP (length=43) Species: 2286 (Saccharolobus shibatae)

CGKCWKTFTDEQLKVLPGVRCPYCGYKIIFMVRKPTIKIVKAI

3D structure

• PDB: 2waq Evolution of complex RNA polymerases: the complete archaeal RNA polymerase structure.
• Chain: P
• Resolution: 3.35 Å

Enzymatic activity

• Enzyme Commision number: 2.7.7.6: DNA-directed RNA polymerase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	ZN	P	C9 C29	C4 C24

Gene Ontology

Molecular Function

• GO:0003677 DNA binding
• GO:0003899 DNA-directed 5'-3' RNA polymerase activity
• GO:0008270 zinc ion binding
• GO:0016779 nucleotidyltransferase activity
• GO:0034062 5'-3' RNA polymerase activity
• GO:0046872 metal ion binding

Biological Process

• GO:0006351 DNA-templated transcription

Cellular Component

• GO:0000428 DNA-directed RNA polymerase complex
• GO:0005737 cytoplasm

External links

• PDB: RCSB:2waq, PDBe:2waq, PDBj:2waq
• PDBsum: 2waq
• PubMed: 19419240
• UniProt: B8YB64|RPO12_SACSH DNA-directed RNA polymerase subunit Rpo12 (Gene Name=rpo12)