Structure of PDB 2vxj Chain P

Receptor sequence

>2vxjP (length=121) Species: 208964 (Pseudomonas aeruginosa PAO1)

AWKGEVLANNEAGQVTSIIYNPGDVITIVAAGWASYGPTQKWGPQGDREH
PDQGLICHDAFCGALVMKIGNSGTIPVNTGLFRWVAPNNVQGAITLIYND
VPGTYGNNSGSFSVNIGKDQS

3D structure

• PDB: 2vxj Structural Basis of the Preferential Binding for Globo-Series Glycosphingolipids Displayed by Pseudomonas Aeruginosa Lectin I.
• Chain: P
• Resolution: 1.9 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	GAL	P	H50 Q53	H50 Q53
BS02	GLA	P	Y36 H50 Q53 D100 T104 N107	Y36 H50 Q53 D100 T104 N107
BS03	CA	P	Y36 D100 T104 N107 N108	Y36 D100 T104 N107 N108

Gene Ontology

Molecular Function

• GO:0030246 carbohydrate binding

Biological Process

• GO:0007157 heterophilic cell-cell adhesion via plasma membrane cell adhesion molecules

Cellular Component

• GO:0005737 cytoplasm
• GO:0009986 cell surface
• GO:0042597 periplasmic space

External links

• PDB: RCSB:2vxj, PDBe:2vxj, PDBj:2vxj
• PDBsum: 2vxj
• PubMed: 18762193
• UniProt: Q05097|PA1L_PSEAE PA-I galactophilic lectin (Gene Name=lecA)