Structure of PDB 2iy4 Chain P |
>2iy4P (length=150) Species: 1639 (Listeria monocytogenes) [Search protein sequence] |
VDTKEFLNHQVANLNVFTVKIHQIHWYMRGHNFFTLHEKMDDLYSEFGEQ MDEVAERLLAIGGSPFSTLKEFLENASVEEAPYTKPKTMDQLMEDLVGTL ELLRDEYQQGIELTDKEGDNVTNDMLIAFKASIDKHIWMFKAFLGKAPLE |
|
PDB | 2iy4 The Mutations Lys 114 --> Gln and Asp 126 --> Asn Disrupt an Intersubunit Salt Bridge and Convert Listeria Innocua Dps Into its Natural Mutant Listeria Monocytogenes Dps. Effects on Protein Stability at Low Ph. |
Chain | P |
Resolution | 2.31 Å |
3D structure |
|
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
FE |
P |
D58 E62 |
D52 E56 |
|
|
|
|