Structure of PDB 2imw Chain P

Receptor sequence

>2imwP (length=348) Species: 2287 (Saccharolobus solfataricus)

MIVLFVDFDYFYAQVEEVLNPSLKGKPVVVCVFSGRFEDSGAVATANYEA
RKFGVKAGIPIVEAKKILPNAVYLPMRKEVYQQVSSRIMNLLREYSEKIE
IASIDEAYLDISDKVRDYREAYNLGLEIKNKILEKEKITVTVGISKNKVF
AKIAADMAKPNGIKVIDDEEVKRLIRELDIADVPGIGNITAEKLKKLGIN
KLVDTLSIEFDKLKGMIGEAKAKYLISLARDEYNEPIRTRVRKSIGRIVT
MKRNSRNLEEIKPYLFRAIEESYYKLDKRIPKAIHVVAVTEDLDIVSRGR
TFPHGISKETAYSESVKLLQKILEEDERKIRRIGVRFSKFIEAIGLDK

3D structure

• PDB: 2imw Mechanism of Template-independent Nucleotide Incorporation Catalyzed by a Template-dependent DNA Polymerase.
• Chain: P
• Resolution: 2.05 Å

Enzymatic activity

• Enzyme Commision number: 2.7.7.7: DNA-directed DNA polymerase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	P	G218 E219 A220 R242 K243 S244 I245 G246 R247 I248 R336 K348	G218 E219 A220 R242 K243 S244 I245 G246 R247 I248 R336 K348
BS02	dna	P	S103 D105 E106 K152 G185 G187 I189 T190 H285 V296 S297 R298	S103 D105 E106 K152 G185 G187 I189 T190 H285 V296 S297 R298
BS03	CA	P	D7 F8 D105	D7 F8 D105
BS04	CA	P	A181 I186	A181 I186
BS05	DDS	P	Y10 A44 T45 R51 K159	Y10 A44 T45 R51 K159

Gene Ontology

Molecular Function

• GO:0000287 magnesium ion binding
• GO:0003677 DNA binding
• GO:0003684 damaged DNA binding
• GO:0003887 DNA-directed DNA polymerase activity
• GO:0046872 metal ion binding

Biological Process

• GO:0006260 DNA replication
• GO:0006261 DNA-templated DNA replication
• GO:0006281 DNA repair
• GO:0006974 DNA damage response
• GO:0042276 error-prone translesion synthesis

Cellular Component

• GO:0005737 cytoplasm

External links

• PDB: RCSB:2imw, PDBe:2imw, PDBj:2imw
• PDBsum: 2imw
• PubMed: 17095011
• UniProt: Q97W02|DPO4_SACS2 DNA polymerase IV (Gene Name=dbh)