Structure of PDB 1vq9 Chain P

Receptor sequence

>1vq9P (length=143) Species: 2238 (Haloarcula marismortui)

TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQ
AKDKKGNSRGRARERQKKRAYGHQKGAGSRKGKAGARQNSKEDWESRIRA
QRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA

3D structure

• PDB: 1vq9 Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
• Chain: P
• Resolution: 2.4 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	P	T1 D2 L3 K7 R8 G17 K18 N19 R20 W22 F23 P25 Q28 T36 R37 R41 K52 K54 K55 G56 N57 S58 R59 R61 R63 R65 Q66 K68 R69 A70 Y71 H73 Q74 K75 G76 G78 R80 K81 G82 K83 A84 G85 A86 R87 Q88 K91 W94 E95 S96 R99 A100 R102 R109 S117 Y119 R120 Y123 D124 G128 E130 S133 V134	T1 D2 L3 K7 R8 G17 K18 N19 R20 W22 F23 P25 Q28 T36 R37 R41 K52 K54 K55 G56 N57 S58 R59 R61 R63 R65 Q66 K68 R69 A70 Y71 H73 Q74 K75 G76 G78 R80 K81 G82 K83 A84 G85 A86 R87 Q88 K91 W94 E95 S96 R99 A100 R102 R109 S117 Y119 R120 Y123 D124 G128 E130 S133 V134

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding
• GO:0070180 large ribosomal subunit rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:1vq9, PDBe:1vq9, PDBj:1vq9
• PDBsum: 1vq9
• PubMed: 16285925
• UniProt: P14119|RL19E_HALMA Large ribosomal subunit protein eL19 (Gene Name=rpl19e)