Structure of PDB 1u8f Chain P

Receptor sequence

>1u8fP (length=333) Species: 9606 (Homo sapiens) [Search protein sequence]

KVKVGVNGFGRIGRLVTRAAFNSGKVDIVAINDPFIDLNYMVYMFQYDST
HGKFHGTVKAENGKLVINGNPITIFQERDPSKIKWGDAGAEYVVESTGVF
TTMEKAGAHLQGGAKRVIISAPSADAPMFVMGVNHEKYDNSLKIISNASC
TTNCLAPLAKVIHDNFGIVEGLMTTVHAITATQKTVDGPSGKLWRDGRGA
LQNIIPASTGAAKAVGKVIPELNGKLTGMAFRVPTANVSVVDLTCRLEKP
AKYDDIKKVVKQASEGPLKGILGYTEHQVVSSDFNSDTHSSTFDAGAGIA
LNDHFVKLISWYDNEFGYSNRVVDLMAHMASKE

3D structure

PDB

1u8f High-resolution structure of human D-glyceraldehyde-3-phosphate dehydrogenase.

Chain

Resolution

1.75 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

1.2.1.12: glyceraldehyde-3-phosphate dehydrogenase (phosphorylating).
2.6.99.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	NAD	P	G10 G12 R13 I14 D35 P36 F37 S98 T99 G100 F102 S122 C152 A183 N316 Y320	G8 G10 R11 I12 D33 P34 F35 S96 T97 G98 F100 S120 C150 A181 N314 Y318

Gene Ontology

	Molecular Function
GO:0004365	glyceraldehyde-3-phosphate dehydrogenase (NAD+) (phosphorylating) activity
GO:0005515	protein binding
GO:0008017	microtubule binding
GO:0016491	oxidoreductase activity
GO:0016620	oxidoreductase activity, acting on the aldehyde or oxo group of donors, NAD or NADP as acceptor
GO:0016740	transferase activity
GO:0019828	aspartic-type endopeptidase inhibitor activity
GO:0035605	peptidyl-cysteine S-nitrosylase activity
GO:0042802	identical protein binding
GO:0050661	NADP binding
GO:0051287	NAD binding
GO:0097718	disordered domain specific binding

	Biological Process
GO:0000226	microtubule cytoskeleton organization
GO:0001819	positive regulation of cytokine production
GO:0006006	glucose metabolic process
GO:0006096	glycolytic process
GO:0006417	regulation of translation
GO:0006915	apoptotic process
GO:0010951	negative regulation of endopeptidase activity
GO:0016241	regulation of macroautophagy
GO:0017148	negative regulation of translation
GO:0031640	killing of cells of another organism
GO:0032481	positive regulation of type I interferon production
GO:0035606	peptidyl-cysteine S-trans-nitrosylation
GO:0043123	positive regulation of canonical NF-kappaB signal transduction
GO:0045087	innate immune response
GO:0050821	protein stabilization
GO:0050832	defense response to fungus
GO:0051402	neuron apoptotic process
GO:0051873	killing by host of symbiont cells
GO:0061844	antimicrobial humoral immune response mediated by antimicrobial peptide
GO:0071346	cellular response to type II interferon

	Cellular Component
GO:0005634	nucleus
GO:0005737	cytoplasm
GO:0005811	lipid droplet
GO:0005829	cytosol
GO:0005856	cytoskeleton
GO:0005886	plasma membrane
GO:0015630	microtubule cytoskeleton
GO:0016020	membrane
GO:0031965	nuclear membrane
GO:0031982	vesicle
GO:0043231	intracellular membrane-bounded organelle
GO:0048471	perinuclear region of cytoplasm
GO:0070062	extracellular exosome
GO:0097452	GAIT complex
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:1u8f, PDBe:1u8f, PDBj:1u8f
PDBsum	1u8f
PubMed	16510976
UniProt	P04406\|G3P_HUMAN Glyceraldehyde-3-phosphate dehydrogenase (Gene Name=GAPDH)

[Back to BioLiP]