Structure of PDB 1skn Chain P

Receptor sequence
>1sknP (length=74) Species: 6239 (Caenorhabditis elegans) [Search protein sequence]
GRQSKDEQLASDNELPVSAFQISEMSLSELQQVLKNESLSEYQRQLIRKI
RRRGKNKVAARTCRQRRTDRHDKM
3D structure
PDB1skn A new DNA-binding motif in the Skn-1 binding domain-DNA complex.
ChainP
Resolution2.5 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna P K460 R507 R508 N511 R516 R519 K5 R52 R53 N56 R61 R64
BS02 dna P R503 R506 K510 C518 R521 R48 R51 K55 C63 R66
Gene Ontology
Molecular Function
GO:0000978 RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0006357 regulation of transcription by RNA polymerase II

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1skn, PDBe:1skn, PDBj:1skn
PDBsum1skn
PubMed9628487
UniProtP34707|SKN1_CAEEL Protein skinhead-1 (Gene Name=skn-1)

[Back to BioLiP]