Structure of PDB 1kqs Chain P

Receptor sequence

>1kqsP (length=95) Species: 2238 (Haloarcula marismortui)

PSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNG
RFHPRFDGQTGTVEGKQGDAYKVDIVDGGKEKTIIVTAAHLRRQE

3D structure

• PDB: 1kqs A pre-translocational intermediate in protein synthesis observed in crystals of enzymatically active 50S subunits.
• Chain: P
• Resolution: 3.1 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	P	P1 S2 S3 N4 G5 P6 L7 E8 G9 R11 G12 K13 L14 K15 R21 G22 T23 K38 H40 K42 P45 S46 P48 H53 R55 F56 G58 Q59 T60 Q67 G68 D69 A70 D77 G79 K80 K82 T83 I85 Q94 E95	P1 S2 S3 N4 G5 P6 L7 E8 G9 R11 G12 K13 L14 K15 R21 G22 T23 K38 H40 K42 P45 S46 P48 H53 R55 F56 G58 Q59 T60 Q67 G68 D69 A70 D77 G79 K80 K82 T83 I85 Q94 E95
BS02	rna	P	R19 P25 Q27	R19 P25 Q27

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:1kqs, PDBe:1kqs, PDBj:1kqs
• PDBsum: 1kqs
• PubMed: 11828326
• UniProt: P12734|RL21_HALMA Large ribosomal subunit protein eL21 (Gene Name=rpl21e)