Structure of PDB 1kj1 Chain P

Receptor sequence
>1kj1P (length=109) Species: 4682 (Allium sativum) [Search protein sequence]
RNLLTNGEGLYAGQSLDVEPYHFIMQEDCNLVLYDHSTSVWASNTGILGK
KGCKAVLQSDGNFVVYDAEGRSLWASHSVRGNGNYVLVLQEDGNVVIYGS
DIWSTGTYK
3D structure
PDB1kj1 Re-refinement using reprocessed data to improve the quality of the structure: a case study involving garlic lectin.
ChainP
Resolution2.2 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 MAN P Q90 D92 N94 Q90 D92 N94
BS02 MAN P Q58 D60 N62 Y66 Q58 D60 N62 Y66
BS03 MAN P Q26 D28 N30 Y34 S39 Q26 D28 N30 Y34 S39
BS04 MAN P Y21 L33 D35 G93 Y21 L33 D35 G93
BS05 MAN P N84 D101 Y108 N84 D101 Y108
External links