Structure of PDB 1i94 Chain P

Receptor sequence
>1i94P (length=88) Species: 274 (Thermus thermophilus) [Search protein sequence]
MVKIRLARFGSKHNPHYRIVVTDARRKRDGKYIEKIGYYDPRKTTPDWLK
VDVERARYWLSVGAQPTDTARRLLRQAGVFRQEAREGA
3D structure
PDB1i94 Crystal structures of complexes of the small ribosomal subunit with tetracycline, edeine and IF3.
ChainP
Resolution3.2 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna P L6 F9 G10 S11 K12 H16 A24 R25 G30 K31 P41 R42 V62 G63 F80 L6 F9 G10 S11 K12 H16 A24 R25 G30 K31 P41 R42 V62 G63 F80
BS02 MG P K27 R28 D29 K27 R28 D29
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1i94, PDBe:1i94, PDBj:1i94
PDBsum1i94
PubMed11296217
UniProtQ5SJH3|RS16_THET8 Small ribosomal subunit protein bS16 (Gene Name=rpsP)

[Back to BioLiP]