Structure of PDB 1b23 Chain P

Receptor sequence

>1b23P (length=405) Species: 271 (Thermus aquaticus)

AKGEFIRTKPHVNVGTIGHVDHGKTTLTAALTYVAAAENPNVEVKDYGDI
DKAPEERARGITINTAHVEYETAKRHYSHVDCPGHADYIKNMITGAAQMD
GAILVVSAADGPMPQTREHILLARQVGVPYIVVFMNKVDMVDDPELLDLV
EMEVRDLLNQYEFPGDEVPVIRGSALLALEEMHKNPKTKRGENEWVDKIW
ELLDAIDEYIPTPVRDVDKPFLMPVEDVFTITGRGTVATGRIERGKVKVG
DEVEIVGLAPETRKTVVTGVEMHRKTLQEGIAGDNVGLLLRGVSREEVER
GQVLAKPGSITPHTKFEASVYILKKEEGGRHTGFFTGYRPQFYFRTTDVT
GVVRLPQGVEMVMPGDNVTFTVELIKPVALEEGLRFAIREGGRTVGAGVV
TKILE

3D structure

• PDB: 1b23 The crystal structure of Cys-tRNACys-EF-Tu-GDPNP reveals general and specific features in the ternary complex and in tRNA.
• Chain: P
• Resolution: 2.6 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): K24 T25 T62 H85
• Catalytic site (residue number reindexed from 1): K24 T25 T62 H85

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	P	I63 N64 Y88 K90 N91 F229 I231 T232 E271 R274 G287 R300 R330 H331 T332 G337 Y338 R339 Q341 T350 I375 K376 E390 G391	I63 N64 Y88 K90 N91 F229 I231 T232 E271 R274 G287 R300 R330 H331 T332 G337 Y338 R339 Q341 T350 I375 K376 E390 G391
BS02	CYS	P	H67 H273 R274 N285	H67 H273 R274 N285
BS03	MG	P	T25 T62	T25 T62
BS04	GNP	P	V20 D21 G23 K24 T25 T26 Y47 I61 T62 G84 N136 K137 D139 M140 S174 L176	V20 D21 G23 K24 T25 T26 Y47 I61 T62 G84 N136 K137 D139 M140 S174 L176

Gene Ontology

Molecular Function

• GO:0003746 translation elongation factor activity
• GO:0003924 GTPase activity
• GO:0005525 GTP binding

Biological Process

• GO:0006412 translation
• GO:0006414 translational elongation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol

External links

• PDB: RCSB:1b23, PDBe:1b23, PDBj:1b23
• PDBsum: 1b23
• PubMed: 10368282
• UniProt: Q01698|EFTU_THEAQ Elongation factor Tu (Gene Name=tuf)