Structure of PDB 7y5e Chain ON

Receptor sequence
>7y5eON (length=92) Species: 35688 (Porphyridium purpureum) [Search protein sequence]
YEISEGSSFDANPLVIGLALIGWVVPSSVPSNIPLLDGKGLTPAFVASIS
DNLSRWPQGPQLADPFWLLMGMWHVGLFATLIFGTVGYNLRK
3D structure
PDB7y5e In situ structure of the red algal phycobilisome-PSII-PSI-LHC megacomplex.
ChainON
Resolution3.3 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CLA ON F54 I61 I127 T130 V131 N134 F9 I16 I82 T85 V86 N89
BS02 CLA ON Q103 G104 W112 Q58 G59 W67
BS03 CLA ON L65 M115 W118 H119 L122 L20 M70 W73 H74 L77
BS04 CLA ON L63 F128 G132 L18 F83 G87
External links