Structure of PDB 8rdw Chain OL

Receptor sequence
>8rdwOL (length=86) Species: 45610 (Psychrobacter urativorans) [Search protein sequence]
MLTNSDREQIIAQYQRGENDTGSPEVQVALLSARINDLQNHFKAHKADHH
SRRGLIRMVNTRRKLLDYLKGKDLGRYTTLISQLGL
3D structure
PDB8rdw A new family of bacterial ribosome hibernation factors
ChainOL
Resolution2.74 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna OL Q39 L55 I56 V59 Q39 L55 I56 V59
BS02 rna OL M1 N4 R7 D20 T21 G22 Q27 R34 L38 H41 H45 D48 H49 H50 S51 R53 R57 N60 K64 Y68 K72 M1 N4 R7 D20 T21 G22 Q27 R34 L38 H41 H45 D48 H49 H50 S51 R53 R57 N60 K64 Y68 K72
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8rdw, PDBe:8rdw, PDBj:8rdw
PDBsum8rdw
PubMed38355796
UniProtA0A0M4TF29

[Back to BioLiP]