Structure of PDB 7y4l Chain OG

Receptor sequence

>7y4lOG (length=177) Species: 35688 (Porphyridium purpureum)

MLDAFSRVVVNSDAKAAYVGGSDLQALKSFIADGNKRLDAVNSIVSNASC
MVSDAVSGMICENPGLISPGGNCYTNRRMAACLRDGEIILRYVSYALLAG
DASVLEDRCLNGLKETYIALGVPTNSSIRAVSIMKAQAVAFITNTATERK
MSFAAGDCTSLASEVASYFDRVGAAIS

3D structure

• PDB: 7y4l In situ structure of the red algal phycobilisome-PSII-PSI-LHC megacomplex.
• Chain: OG
• Resolution: 3.3 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	PEB	OG	N72 R77 R78 C82 R84 D85 I88 C109 Y117 L120 V122 P123	N72 R77 R78 C82 R84 D85 I88 C109 Y117 L120 V122 P123
BS02	PEB	OG	N35 K36 L38 D39 N42 I142 F153 A154 A155 D157 C158	N35 K36 L38 D39 N42 I142 F153 A154 A155 D157 C158
BS03	PEB	OG	C50 D54 C61 S132 I133 A136 Q137 A140 F141 A146 E148 R149	C50 D54 C61 S132 I133 A136 Q137 A140 F141 A146 E148 R149
BS04	PEB	OG	I60 Y74 N76 M79	I60 Y74 N76 M79

Gene Ontology

Biological Process

• GO:0015979 photosynthesis

Cellular Component

• GO:0009507 chloroplast
• GO:0009535 chloroplast thylakoid membrane
• GO:0009579 thylakoid
• GO:0016020 membrane
• GO:0030089 phycobilisome

External links

• PDB: RCSB:7y4l, PDBe:7y4l, PDBj:7y4l
• PDBsum: 7y4l
• PubMed: 36922595
• UniProt: P11393|PHEB_PORPP B-phycoerythrin beta chain (Gene Name=cpeB)