Structure of PDB 6boh Chain OC

Receptor sequence
>6bohOC (length=110) Species: 562 (Escherichia coli) [Search protein sequence]
PKDPDDERNAFLEVRAGTGGDEAALFAGDLFRMYSRYAEARRWRVEIMSA
SEGEHGGYKEIIAKISGDGVYGRLKFESGGHRVQRVPATESQGRIHTSAC
TVAVMPELPD
3D structure
PDB6boh Conformational Control of Translation Termination on the 70S Ribosome.
ChainOC
Resolution3.4 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna OC T119 R183 Q185 S192 Q193 I196 T18 R82 Q84 S91 Q92 I95
BS02 rna OC R116 E161 R15 E60
BS03 rna OC G120 T190 R195 I196 H197 T198 G19 T89 R94 I95 H96 T97
Gene Ontology
Molecular Function
GO:0003747 translation release factor activity
GO:0005515 protein binding
GO:0016149 translation release factor activity, codon specific
GO:0043022 ribosome binding
Biological Process
GO:0006412 translation
GO:0006415 translational termination
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6boh, PDBe:6boh, PDBj:6boh
PDBsum6boh
PubMed29731232
UniProtP0A7I0|RF1_ECOLI Peptide chain release factor RF1 (Gene Name=prfA)

[Back to BioLiP]