Structure of PDB 5juu Chain OB

Receptor sequence
>5juuOB (length=117) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]
GRVRTKTVKRASKALIERYYPKLTLDFQTNKRLCDEIATIQSKRLRNKIA
GYTTHLMKRIQKGPVRGISFKLQEEERERKDQYVPEVSALDLSRSNGVLN
VDNQTSDLVKSLGLKLP
3D structure
PDB5juu Ensemble cryo-EM uncovers inchworm-like translocation of a viral IRES through the ribosome.
ChainOB
Resolution4.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna OB G2 R3 V4 R5 T6 K7 K10 F28 K32 K44 R45 L46 R47 N48 R60 R67 G1 R2 V3 R4 T5 K6 K9 F27 K31 K43 R44 L45 R46 N47 R59 R66
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0000028 ribosomal small subunit assembly
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5juu, PDBe:5juu, PDBj:5juu
PDBsum5juu
PubMed27159452
UniProtP02407|RS17A_YEAST Small ribosomal subunit protein eS17A (Gene Name=RPS17A)

[Back to BioLiP]