Structure of PDB 4wro Chain O8

Receptor sequence
>4wroO8 (length=45) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]
LLLECTECKRRNYATEKNKRNTPNKLELRKYCPWCRKHTVHREVK
3D structure
PDB4wro Structural insights into the translational infidelity mechanism.
ChainO8
Resolution3.05 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna O8 R18 R19 T23 E24 K25 K27 R28 P31 R37 K38 Y39 C40 W42 K45 H46 K53 R10 R11 T15 E16 K17 K19 R20 P23 R29 K30 Y31 C32 W34 K37 H38 K45
Gene Ontology
Molecular Function
GO:0000049 tRNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4wro, PDBe:4wro, PDBj:4wro
PDBsum4wro
PubMed26037619
UniProtP35871|RL33_THET8 Large ribosomal subunit protein bL33 (Gene Name=rpmG)

[Back to BioLiP]