Structure of PDB 4u53 Chain O7

Receptor sequence

>4u53O7 (length=87) Species: 559292 (Saccharomyces cerevisiae S288C)

GKGTPSFGKRHNKSHTLCNRCGRRSFHVQKKTCSSCGYPAAKTRSYNWGA
KAKRRHTTGTGRMRYLKHVSRRFKNGFQTGSASKASA

3D structure

• PDB: 4u53 ?
• Chain: O7
• Resolution: 3.3 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	O7	G2 K3 G4 T5 P6 S7 F8 G9 K10 R11 H12 N13 K14 S15 H16 R24 R25 S26 H28 Q30 S35 S36 K43 T44 R45 Y47 N48 W49 K52 R55 R56 T59 S71 K75	G1 K2 G3 T4 P5 S6 F7 G8 K9 R10 H11 N12 K13 S14 H15 R23 R24 S25 H27 Q29 S34 S35 K42 T43 R44 Y46 N47 W48 K51 R54 R55 T58 S70 K74
BS02	rna	O7	T17 R21 G23 V29 K32 A42 T59 G60 G62 R63 M64 R65 Y66 L67 K68 V70 R72 F74 N76 Q79 T80 G81 S82 A83 S84 K85 A86 S87 A88	T16 R20 G22 V28 K31 A41 T58 G59 G61 R62 M63 R64 Y65 L66 K67 V69 R71 F73 N75 Q78 T79 G80 S81 A82 S83 K84 A85 S86 A87
BS03	OHX	O7	T44 S46	T43 S45
BS04	OHX	O7	G60 G62	G59 G61
BS05	ZN	O7	C19 C22 C34 C37	C18 C21 C33 C36
BS06	OHX	O7	S87 A88	S86 A87

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0008270 zinc ion binding
• GO:0019843 rRNA binding
• GO:0046872 metal ion binding

Biological Process

• GO:0000448 cleavage in ITS2 between 5.8S rRNA and LSU-rRNA of tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
• GO:0002181 cytoplasmic translation
• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:0030687 preribosome, large subunit precursor
• GO:0044391 ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:4u53, PDBe:4u53, PDBj:4u53
• PDBsum: 4u53
• PubMed: 25209664
• UniProt: P49166|RL37A_YEAST Large ribosomal subunit protein eL37A (Gene Name=RPL37A)