Structure of PDB 5ndv Chain O6

Receptor sequence
>5ndvO6 (length=97) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]
TVKTGIAIGLNKGKKVTSMTPAPKISYKKGAASNRTKFVRSLVREIAGLS
PYERRLIDLIRNSGEKRARKVAKKRLGSFTRAKAKVEEMNNIIAASR
3D structure
PDB5ndv Aminoglycoside interactions and impacts on the eukaryotic ribosome.
ChainO6
Resolution3.3 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna O6 G14 K15 K25 I26 S27 Y28 K30 G31 A32 A33 S34 N35 R36 T37 R41 Y53 D59 N63 R68 K75 R76 L77 G78 F80 R82 K84 K86 G13 K14 K24 I25 S26 Y27 K29 G30 A31 A32 S33 N34 R35 T36 R40 Y52 D58 N62 R67 K74 R75 L76 G77 F79 R81 K83 K85
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
Biological Process
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5ndv, PDBe:5ndv, PDBj:5ndv
PDBsum5ndv
PubMed29208708
UniProtP05745|RL36A_YEAST Large ribosomal subunit protein eL36A (Gene Name=RPL36A)

[Back to BioLiP]