Structure of PDB 4u53 Chain O5

Receptor sequence

>4u53O5 (length=119) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]

AGVKAYELRTKSKEQLASQLVDLKKELAELKVQKLSRPSLPKIKTVRKSI
ACVLTVINEQQREAVRQLYKGKKYQPKDLRAKKTRALRRALTKFEASQVT
EKQRKKQIAFPQRKYAIKA

3D structure

PDB

4u53 ?

Chain

Resolution

3.3 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	O5	Y75 R81 R86 R90 T93 K94 F95 E102 K103 K106 F111 K115	Y74 R80 R85 R89 T92 K93 F94 E101 K102 K105 F110 K114
BS02	rna	O5	K5 A6 Y7 R10 K35 L41 P42 K43 K45 K49 A52 C53 T56 N59 R63 R67 K78 R81 A82 K83 T85 R86 R89	K4 A5 Y6 R9 K34 L40 P41 K42 K44 K48 A51 C52 T55 N58 R62 R66 K77 R80 A81 K82 T84 R85 R88

Gene Ontology

	Molecular Function
GO:0003729	mRNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0000463	maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:0030687	preribosome, large subunit precursor
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:4u53, PDBe:4u53, PDBj:4u53
PDBsum	4u53
PubMed	25209664
UniProt	P0CX84\|RL35A_YEAST Large ribosomal subunit protein uL29A (Gene Name=RPL35A)