Structure of PDB 8bn3 Chain O4

Receptor sequence

>8bn3O4 (length=109) Species: 4932 (Saccharomyces cerevisiae)

AQRVTFRRRNPYNTRSNKIKVVKTPGGILRAQHVKKLATRPKCGDCGSAL
QGISTLRPRQYATVSKTHKTVSRAYGGSRCANCVKERIIRAFLIEEQKIV
KKVVKEQTE

3D structure

• PDB: 8bn3 Evolving precision: rRNA Expansion Segment 7S enhances translation accuracy in eukaryal ribosomes
• Chain: O4
• Resolution: 2.4 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	O4	A2 R4 V5 T6 F7 R8 R9 R10 N11 P12 Y13 N14 T15 R16 S17 K24 T25 P26 G27 L30 R31 K36 K37 L38 T40 R41 K43 G45 Q52 G53 I54 S55 T56 R58 P59 R60 Y62 A63 T64 S66 K67 T68 K70 T71 S73 R74 Y76 G78 N83 R88 R91 A92 I95 E96 Q98 K99 K102	A1 R3 V4 T5 F6 R7 R8 R9 N10 P11 Y12 N13 T14 R15 S16 K23 T24 P25 G26 L29 R30 K35 K36 L37 T39 R40 K42 G44 Q51 G52 I53 S54 T55 R57 P58 R59 Y61 A62 T63 S65 K66 T67 K69 T70 S72 R73 Y75 G77 N82 R87 R90 A91 I94 E95 Q97 K98 K101
BS02	ZN	O4	C44 C47 C81 C84	C43 C46 C80 C83

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0002181 cytoplasmic translation
• GO:0006412 translation
• GO:0042254 ribosome biogenesis

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:0030687 preribosome, large subunit precursor
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8bn3, PDBe:8bn3, PDBj:8bn3
• PDBsum: 8bn3
• PubMed: 38324474
• UniProt: P87262|RL34A_YEAST Large ribosomal subunit protein eL34A (Gene Name=RPL34A)