Structure of PDB 6gzx Chain O4

Receptor sequence
>6gzxO4 (length=88) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHH
SHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIRG
3D structure
PDB6gzx Cryo-EM structure of the hibernating Thermus thermophilus 100S ribosome reveals a protein-mediated dimerization mechanism.
ChainO4
Resolution4.57 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna O4 I87 R88 G89 I86 R87 G88
BS02 rna O4 P2 K8 T22 G23 S24 Q28 R35 L39 K48 D49 H50 H51 R54 G55 L57 M58 M59 R64 R65 P1 K7 T21 G22 S23 Q27 R34 L38 K47 D48 H49 H50 R53 G54 L56 M57 M58 R63 R64
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6gzx, PDBe:6gzx, PDBj:6gzx
PDBsum6gzx
PubMed30301898
UniProtQ5SJ76|RS15_THET8 Small ribosomal subunit protein uS15 (Gene Name=rpsO)

[Back to BioLiP]