Structure of PDB 8r3v Chain O2

Receptor sequence
>8r3vO2 (length=88) Species: 562 (Escherichia coli) [Search protein sequence]
SLSTEATAKIVSEFGRDANDTGSTEVQVALLTAQINHLQGHFAEHKKDHH
SRRGLLRMVSQRRKLLDYLKRKDVARYTQLIERLGLRR
3D structure
PDB8r3v Transient disome complex formation in native polysomes during ongoing protein synthesis captured by cryo-EM.
ChainO2
Resolution3.28 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 rna O2 Q40 R53 L56 V60 R88 Q39 R52 L55 V59 R87
BS02 rna O2 S2 T5 T8 N20 D21 T22 G23 S24 Q28 L31 H38 L39 H42 H46 K48 D49 H50 H51 S52 R54 S61 K65 Y69 R72 K73 S1 T4 T7 N19 D20 T21 G22 S23 Q27 L30 H37 L38 H41 H45 K47 D48 H49 H50 S51 R53 S60 K64 Y68 R71 K72
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
GO:0070181 small ribosomal subunit rRNA binding
Biological Process
GO:0000028 ribosomal small subunit assembly
GO:0002181 cytoplasmic translation
GO:0006412 translation
GO:0006417 regulation of translation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:8r3v, PDBe:8r3v, PDBj:8r3v
PDBsum8r3v
PubMed38409277
UniProtP0ADZ4|RS15_ECOLI Small ribosomal subunit protein uS15 (Gene Name=rpsO)

[Back to BioLiP]