Structure of PDB 7r81 Chain O2

Receptor sequence

>7r81O2 (length=150) Species: 5141 (Neurospora crassa) [Search protein sequence]

GRMHSKGKGISASAIPYSRNPPSWLKTTPEQVVDQICKLAKKGATPSQIG
VILRDSHGIAQVKVVTGNKILRILKSNGLAPDLPEDLYMLIKKAVAVRKH
LERNRKDKDSKFRLILIESRIHRLARYYKTVGVLPPTWKYESSTASTIVS

3D structure

PDB

7r81 Structure of the translating Neurospora ribosome arrested by cycloheximide

Chain

Resolution

2.7 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	O2	H123 K140	H122 K139
BS02	rna	O2	G2 R3 M4 H5 K7 G8 K9 G10 I11 S12 A13 S14 A15 P17 R20 P47 S48 G51 R55 A61 K64 K70 L72 R73 K76 D87 M90 H101 K107 D108 K109 K112 F113 R114 I116 L117 S120 R121 R124 Y128	G1 R2 M3 H4 K6 G7 K8 G9 I10 S11 A12 S13 A14 P16 R19 P46 S47 G50 R54 A60 K63 K69 L71 R72 K75 D86 M89 H100 K106 D107 K108 K111 F112 R113 I115 L116 S119 R120 R123 Y127

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0070181	small ribosomal subunit rRNA binding

	Biological Process
GO:0000462	maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0006412	translation

	Cellular Component
GO:0005730	nucleolus
GO:0005737	cytoplasm
GO:0005840	ribosome
GO:0022627	cytosolic small ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7r81, PDBe:7r81, PDBj:7r81
PDBsum	7r81
PubMed	34815343
UniProt	Q7SDH0

[Back to BioLiP]